Peptides

B-type Natriuretic Peptide, BNP-45 (51-95), rat - 0.5 mg

$361.00
Check your price
  • Cat.Number : AS-61153
  • Availability :
    In stock

Alternative choices

Quantity

BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. Further, sequence identity between rat and mouse BNP prohormones is found to be more conserved in the N-terminal portion of the prohormone than in the C-terminal BNP-45 (88% versus 64%). The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence. Comparing the amino acid sequence surrounding the proteolytic processing site for BNP-32 in human, pig, and dog BNP with the corresponding site for BNP-45 in the rat and mouse sequence we find that all of the secreted BNP hormones have an N-terminal serine preceded by an arginine in the prohormone sequence, and the mouse and rat sequences are highly conserved at the putative scissile bond (LKRVLR-SQ). Further comparative sequence analysis indicates that an arginine being present at position -4 relative to the scissile (R-S) bond in all mammalian BNP precursors. Thus, processing of BNP prohormones to both BNP-45 in rodents and BNP-32 in higher mammals appears to require a protease with a conserved recognition sequence (RXXR-S). Also, the conserved sequences in the BNP prohormones matches the consensus cleavage site for human furin, a calcium-dependent serine endoprotease expressed in mouse heart, and possibly having a role in processing BNP precursors.

Specifications

Chemistry
Sequence one letter code
  • SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
Sequence three letter code
  • H-Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (Disulfide bridge:23-39)
CAS registry number
  • 123337-89-3
Molecular Formula
  • C213H349N71O65S3
Molecular Mass/ Weight
  • 5041
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • rat
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of ANP(1-28) peptide, human peptide, porcine

Atrial Natriuretic Peptide (1-28), human, porcine

Cat.Number : AS-20647
$166.00 Excl. Tax
Tube of CNP peptide, human,porcine

C-Type Natriuretic Peptide (32-53), human, porcine - 1 mg

Cat.Number : AS-24244
$262.00 Excl. Tax
Image of a kit SensoLyte 390 ACE2 Activity Assay Kit Fluorimetric

SensoLyte® 390 ACE2 Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72086
$539.00 Excl. Tax