Peptides

Beta-Amyloid (1-40) • HCl

$364.00
Check your price
  • Cat.Number : AS-20698
  • Availability :
    In stock

Size

Alternative choices

Quantity

All the HCl salt forms of Aß (1-40), Aß (25-35) and D-Ser26 Aß (25-35), take the ß-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV • HCl
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH • HCl
CAS registry number
  • 131438-79-4
Molecular Formula
  • C194H295N53O58S
Molecular Mass/ Weight
  • 4329.9•36.5
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of 1percent NH4OH solution 300 µl peptide

1 % NH4OH solution - 300 µl

Cat.Number : AS-61322
$27.00 Excl. Tax
Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
$341.00 Excl. Tax

Citations

Transcriptional Profile of HIV-induced Nuclear Translocation of Amyloid β in Brain Endothelial Cells.

Arch Med Res . 2014 Nov 24 ; 45(8) 744 | DOI : 10.1016/j.arcmed.2014.11.003.

  • IE. András
  • et al

Reversibility of β-amyloid self-assembly: Effects of pH and added salts assessed by fluorescence photobleaching recovery.

Biomacromolecules . 2010 Feb 08 ; 11(2) 341 | DOI : 10.1021/bm900833b.

  • NJ. Edwin
  • et al

Inhibition of Alzheimer's amyloid-β peptide-induced reduction of mitochondrial membrane potential and neurotoxicity by gelsolin.

Neurobiol Aging . 2005 Jun 01 ; 26(6) 849 | DOI : 10.1016/j.neurobiolaging.2004.08.003.

  • H. Qiao
  • et al

Amyloid beta peptide‐induced cerebral neuronal loss is mediated by caspase‐3 in vivo.

J Neuropathol Exp Neurol . 2004 Mar 01 ; 63(3) 255 | DOI : 10.1093/jnen/63.3.255

  • H. Takuma
  • et al

RS‐4252 Inhibits Amyloid β‐Induced Cytotoxicity in HeLa Cells.

Pharmacol Toxicol . 2003 Jun 26 ; 93(1) 29 | DOI : 10.1034/j.1600-0773.2003.930104.x.

  • S. Nishimura
  • et al

Microglial activation and amyloid-β clearance induced by exogenous heat-shock proteins.

FASEB J . 2002 Apr 01 ; 16(6) 601 | DOI : 10.1096/fj.01-0530fje.

  • J-I. Kakimura
  • et al

Amyloid β-peptide alters the distribution of early endosomes and inhibits phosphorylation of Akt in the presence of 3-(4, 5-dimethylthiazol-2-yl)-2, 5-diphenyltetrazolium bromide (MTT).

Mol Brain Res . 2002 Oct 15 ; 106(1-2) 94 | DOI : 10.1016/S0169-328X(02)00416-3.

  • T. Kubo
  • et al