Peptides

Anti-BetaGamma (MPS-Phosducin-like protein C terminus)

223,00
Check your price
  • Cat.Number : AS-24177
  • Availability :
    In stock

Size

Quantity

This is a membrane-permeable phosphoducin-like anti-β? peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminal residues of phosducin-like protein (PhLP). This region of PhLP has been shown to confer interactions with Gβ?-mediated signaling. Specifically, it was shown to have inhibitory effects on Go GTPase activity, demonstrating the ability to bind Gβ?, and inhibition of Gβ?-enhanced rhodopsin phosphorylation by βARK. The PhLP shares amino acid sequence homology with phosphoducin, a phosphoprotein expressed in the retina and pineal gland. These proteins have been shown to regulate G-protein signaling by binding to the beta-gamma subunits of G proteins.

Specifications

Chemistry
Sequence one letter code
  • AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
Sequence three letter code
  • H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Val-Thr-Asp-Gln-Leu-Gly-Glu-Asp-Phe-Phe-Ala-Val-Asp-Leu-Glu-Ala-Phe-Leu-Gln-Glu-Phe-Gly-Leu-Leu-Pro-Glu-Lys-Glu-OH
Molecular Formula
  • C217H340N46O63
Molecular Mass/ Weight
  • 4601.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • mouse, rat

You may also be interested in the following product(s)

Tube of (Arg)9 peptide

(Arg)9 - 1 mg

Cat.Number : AS-61204
56,00
Tube of FITC-LC-Antennapedia Peptide

FITC-LC-Antennapedia Peptide

Cat.Number : AS-24175
149,00
Tube of TAT (47-57) peptide, TAMRA-labeled

TAT (47-57), TAMRA-labeled - 1 mg

Cat.Number : AS-61211
213,00

Citations

Cardioprotective effect of histamine H3-receptor activation: pivotal role of Gβγ-dependent inhibition of voltage-operated Ca2+ channels.

J Pharmacol Exp Ther . 2008 Jun 03 ; 326(3) 871 | DOI : 10.1124/jpet.108.137919.

  • C. Morrey
  • et al

Interaction between adenosine A2B- receptors and α2-adrenoreceptors on the modulation of noradrenalin release in the rat vas deferens: Possible involvement of a group 2 adenylyl cyclase isoform.

Neurochem Intl . 2005 Nov 01 ; 47(6) 418 | DOI : 10.1016/j.neuint.2005.05.013.

  • Carlos Talaia
  • et al