Products

Explore our selection of amplification and labeling reagents, peptides, proteins, and more. Find also antibodies, assay kits, and other tools for your lab.

    1 - 20 of 2093

    Big Gastrin-1, human - 0.5 mg

    • Pyr-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
    • Cat.Number : AS-20747

    Bombesin - 1 mg

    • Pyr-QRLGNQWAVGHLM-NH2
    • Cat.Number : AS-20665

    Parathyroid Hormone (1-34), human - 1 mg

    • SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
    • Cat.Number : AS-20708

    MAPS, Core, 8-Branch - 10 mg

    • (K)4-(K)2-K-A
    • Cat.Number : AS-21006

    Glucagon (1-37), Oxyntomodulin, porcine - 1 mg

    • HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
    • Cat.Number : AS-22455

    Calcitonin, salmon - 5 mg

    • CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
    • Cat.Number : AS-20678

    Suc-Arg-Pro-Tyr-pNA - 5 mg

    • Suc-RPY-pNA
    • Cat.Number : AS-20586

    PACAP (1-27), amide, human, ovine, rat - 0.5 mg

    • HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
    • Cat.Number : AS-22527

    ACTH (18-39), human (CLIP) - 1 mg

    • RPVKVYPNGAEDESAEAFPLEF
    • Cat.Number : AS-20619

    Beta-Amyloid (1-11) - 1 mg

    • DAEFRHDSGYE
    • Cat.Number : AS-22819

    Corticotropin Releasing Factor, CRF, ovine - 0.5 mg

    • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
    • Cat.Number : AS-22932

    GRGDTP - 5 mg

    • GRGDTP
    • Cat.Number : AS-22948

    HIV Protease FRET Substrate I - 1 mg

    • DABCYL-GABA-SQNYPIVQ-EDANS
    • Cat.Number : AS-22992

    Galanin, human - 1 mg

    • GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
    • Cat.Number : AS-22431

    [Ser25]-PKC (19-31), biotinylated - 1 mg

    • K(Biotin)-RFARKGSLRQKNV
    • Cat.Number : AS-23018

    ACTH (1-10) - 5 mg

    • SYSMEHFRWG
    • Cat.Number : AS-20624
      1 - 20 of 2093