Peptides

PACAP (1-27), amide, human, ovine, rat - 0.5 mg

132.00
Check your price
  • Cat.Number : AS-22527
  • Availability :
    In stock

Select specification

Quantity

PACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.

Specifications

Chemistry
Sequence one letter code
  • HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Sequence three letter code
  • H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2
CAS registry number
  • 127317-03-7
Molecular Formula
  • C142H224N40O39S
Molecular Mass/ Weight
  • 3147.8
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human, ovine, rat
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of (Arg8)-Vasopressin (AVP) peptide

[Arg8]-Vasopressin (AVP) Peptide

Cat.Number : AS-24289
33.00 Excl. Tax
Tube of ACTH (1-39) peptide, human

ACTH (1-39), human

Cat.Number : AS-20611
214.00 Excl. Tax
Tube of Oxytocin peptide

Oxytocin Peptide

Cat.Number : AS-24275
71.00 Excl. Tax

Citations

Pituitary adenylate cyclase-activating polypeptide regulates brain-derived neurotrophic factor exon IV expression through the VPAC1 receptor in the amphibian melanotrope cell

Endocrinology . 2008 May 01 ; 149(8) 4177 | DOI : 10.1210/en.2008-0131

  • A. Kidane
  • et al

Actions of PACAP and VIP on melanotrope cells of Xenopus laevis

Peptides . 2007 Mar 30 ; 28(9) 1790 | DOI : 10.1016/j.peptides.2007.03.013

  • A. Kidane
  • et al

Soluble adenylyl cyclase is required for netrin-1 signaling in nerve growth cones

Nat Neurosci. . 2006 Sep 10 ; 9(10) 1257 | DOI : 10.1038/nn1767

  • K. Wu
  • et al