Peptides

We offer custom and catalog peptides, GMP grade peptides. Catalog peptides are 95% purity by HPLC unless otherwise specified.

    1 - 20 of 1100

    Biotin-Bradykinin - 1 mg

    • Biotin-RPPGFSPFR
    • Cat.Number : AS-23974

    Cecropin B - 0.5 mg

    • KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
    • Cat.Number : AS-24011

    Glucagon (1-37), Oxyntomodulin, porcine - 1 mg

    • HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
    • Cat.Number : AS-22455

    PACAP (1-38), amide, human, ovine, rat, Biotin-labeled - 0.5 mg

    • Biotin-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
    • Cat.Number : AS-23590

    PACAP (1-27), amide, human, ovine, rat - 0.5 mg

    • HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
    • Cat.Number : AS-22527

    Beta-Amyloid (1-11) - 1 mg

    • DAEFRHDSGYE
    • Cat.Number : AS-22819

    Biotin-Corticotropin Releasing Factor, Biotin-CRF, human, rat - 0.5 mg

    • Biotin-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
    • Cat.Number : AS-23976

    Corticotropin Releasing Factor, CRF, ovine - 0.5 mg

    • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
    • Cat.Number : AS-22932

    H-Ala-Pro-AFC - 10 mg

    • AP-AFC
    • Cat.Number : AS-24126

    GRGDTP - 5 mg

    • GRGDTP
    • Cat.Number : AS-22948

    VIP, human, porcine, rat, FAM-labeled - 0.5 mg

    • FAM-HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
    • Cat.Number : AS-23614

    HIV Protease FRET Substrate I - 1 mg

    • DABCYL-GABA-SQNYPIVQ-EDANS
    • Cat.Number : AS-22992

    Galanin, human - 1 mg

    • GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
    • Cat.Number : AS-22431

    ß-Secretase Inhibitor 1 - 1 mg

    • KTEEISEVN-Sta-VAEF (Sta = statine)
    • Cat.Number : AS-23958

    [Ser25]-PKC (19-31), biotinylated - 1 mg

    • K(Biotin)-RFARKGSLRQKNV
    • Cat.Number : AS-23018

    Biotin-Dynorphin A (1-17) Peptide Fragment - 1 mg

    • Biotin-YGGFLRRIRPKLKWDNQ
    • Cat.Number : AS-23978

    Biotin-ACTH (1-39), human - 0.5 mg

    • Biotin-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
    • Cat.Number : AS-23968
      1 - 20 of 1100