Peptides

Glucagon (1-37), Oxyntomodulin, porcine - 1 mg

651.00
Check your price
  • Cat.Number : AS-22455
  • Availability :
    In stock

Quantity

Following nutrient ingestion, both GLP-1, and Oxyntomodulin (OXM) are processed from proglucagon and secreted from the gut endocine L-cells. Oxyntomodulin (OXM), a 37-amino acid peptide hormone, causes weight loss in humans and rodents. It activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). It contains the same sequence as Glucagon (1-9), but with an additional KRNKNNIA C-terminal sequence.

Specifications

Chemistry
Sequence one letter code
  • HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Sequence three letter code
  • H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH
CAS registry number
  • 159002-68-3
Molecular Formula
  • C192H295N59O60S1
Molecular Mass/ Weight
  • 4422.1
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • porcine
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of GIP peptide, rat

GIP, rat

Cat.Number : AS-65568-05
198.00 Excl. Tax

Citations

A novel high-sensitivity electrochemiluminescence (ECL) sandwich immunoassay for the specific quantitative measurement of plasma glucagon.

Clin Biochem . 2012 Aug 04 ; 45(18) 1640 | DOI : 10.1016/j.clinbiochem.2012.07.111.

  • JH. Sloan
  • et al