Peptides

Corticotropin Releasing Factor, CRF, ovine - 0.5 mg

147,00
Check your price
  • Cat.Number : AS-22932
  • Availability :
    In stock

Select specification

Quantity

The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.

Specifications

Chemistry
Sequence one letter code
  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Sequence three letter code
  • H-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
CAS registry number
  • 79804-71-0
Molecular Formula
  • C205H339N59O63S
Molecular Mass/ Weight
  • 4670.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • ovine

You may also be interested in the following product(s)

Tube of (Arg8)-Vasopressin (AVP) peptide

[Arg8]-Vasopressin (AVP) Peptide

Cat.Number : AS-24289
30,00
Tube of ACTH (1-39) peptide, human

ACTH (1-39), human

Cat.Number : AS-20611
198,00
Tube of Oxytocin peptide

Oxytocin Peptide

Cat.Number : AS-24275
66,00