Peptides

[Arg6]-beta-Amyloid (1-40), England Mutation - 0.5 mg

223,00
Check your price
  • Cat.Number : AS-63321
  • Availability :
    In stock

Select specification

Quantity

Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the English mutation, with His at position 6 replaced with Arg, was reported to accelerate the kinetics of oligomers formation which act as fibril seeds and are more toxic to cultured neuronal cells.

Specifications

Chemistry
Sequence one letter code
  • DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-Arg-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 1802084-26-9
Molecular Formula
  • C194H300N54O58S
Molecular Mass/ Weight
  • 4348,9
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

Tube AggreSure Beta-Amyloid (1-40), human - 0.25 mg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
243,00
Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
263,00