Peptides

[Asn23]-beta-Amyloid (1-40), Iowa Mutation - 0.5 mg

213,00
Check your price
  • Cat.Number : AS-62145
  • Availability :
    In stock

Select specification

Quantity

Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. The Iowa mutation, where Asp 23 is replaced with Asn, is associated with severe cerebral amyloid beta-protein angiopathy (CAA). The affected individuals share a missense mutation in APP at position 694. The mutated beta-amyloid peptide aggregates more rapidly and forms toxic fibrils.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 374796-72-2
Molecular Formula
  • C194H296N54O57S
Molecular Mass/ Weight
  • 4329.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube AggreSure Beta-Amyloid (1-40), human - 0.25 mg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
250,00
Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
271,00