Peptides

Beta-Amyloid (1-40), HiLyte™ Fluor 555-labeled - 0.1 mg

224.00
Check your price
  • Cat.Number : AS-60492-01
  • Availability :
    In stock

Select specification

Quantity

Beta-Amyloid (1-40) together with beta-Amyloid (1-42) are two major C-terminal variants of the beta-Amyloid protein. These beta-Amyloid peptides undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This is a fluorescent (HiLyte™ Fluor 555)-labeled ß-Amyloid peptide, Abs/Em=551/567 nm. Hilyte™ Fluor 555 labeled Aß (1-40) is more photostable than Cy3®-labeled Abeta (1-40).

551/567

Specifications

Chemistry
Sequence one letter code
  • HiLyte Fluor™ 555-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • Hilyte™ Fluor 555-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Molecular Mass/ Weight
  • 5182.3
Properties
Absorbance (nm)
  • 551
Emission (nm)
  • 567
Modification
Conjugation type
  • Fluorescent dyes
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C Protected from light
Activity
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube AggreSure Beta-Amyloid (1-40), human - 0.25 mg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
263.00 Excl. Tax
Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
285.00 Excl. Tax

Citations

LRP promotes endocytosis and degradation, but not transcytosis, of the amyloid-β peptide in a blood–brain barrier in vitro model

Neurobiol Dis. . 2008 Apr 01 ; 30(1) 94 | DOI : 10.1016/j.nbd.2007.12.005

  • B. Nazer
  • et al

Microglia constitute a barrier that prevents neurotoxic protofibrillar ​Aβ42 hotspots around plaques

Nat Commun. . 2015 Jan 29 ; 6 6176 | DOI : 10.1038/ncomms7176

  • C. Condello
  • et al

Identification of BACE2 as an avid ß-amyloid-degrading protease

Mol Neurodegener . 2012 Sep 17 ; 7 46 | DOI : 10.1186/1750-1326-7-46

  • SO. Abdul-Hay
  • et al

Direct Observations of Amyloid β Self-Assembly in Live Cells Provide Insights into Differences in the Kinetics of Aβ(1–40) and Aβ(1–42) Aggregation

Chem Biol. . 2014 Jun 19 ; 21(6) 732 | DOI : 10.1016/j.chembiol.2014.03.014

  • EK. Esbjörner
  • et al

Rare Individual Amyloid-β Oligomers Act on Astrocytes to Initiate Neuronal Damage

Biochemistry. . 2014 Apr 09 ; 53(15) 2442 | DOI : 10.1021/bi401606f

  • P. Narayan
  • et al

Amyloid beta protein-induced zinc sequestration leads to synaptic loss via dysregulation of the ProSAP2/Shank3 scaffold.

Mol Neurodegener . 2011 Sep 22 ; 6 65 | DOI : 10.1186/1750-1326-6-65.

  • AM. Grabrucker
  • et al