Peptides

Beta-Amyloid (1-40), HiLyte™ Fluor 647-labeled - 0.1 mg

224.00
Check your price
  • Cat.Number : AS-60493
  • Availability :
    In production

Select specification

Quantity

Beta-Amyloid (1-40) together with beta-Amyloid (1-42) are two major C-terminal variants of the beta-Amyloid protein. These beta-Amyloid peptides undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is labeled with HiLyte™ Fluor 647: Ex/Em=649/674 nm.

649/674

Specifications

Chemistry
Sequence one letter code
  • HiLyte Fluor™ 647-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • HiLyte™ Fluor647-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Molecular Mass/ Weight
  • 5315.4
Properties
Absorbance (nm)
  • 649
Emission (nm)
  • 674
Modification
Conjugation type
  • Fluorescent dyes
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C Protected from light
Activity
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube AggreSure Beta-Amyloid (1-40), human - 0.25 mg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
263.00 Excl. Tax
Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
285.00 Excl. Tax

Citations

Direct Observations of Amyloid β Self-Assembly in Live Cells Provide Insights into Differences in the Kinetics of Aβ(1–40) and Aβ(1–42) Aggregation

Chem Biol. . 2014 Jun 19 ; 21(6) 732 | DOI : 10.1016/j.chembiol.2014.03.014

  • EK. Esbjörner
  • et al

Rare Individual Amyloid-β Oligomers Act on Astrocytes to Initiate Neuronal Damage

Biochemistry. . 2014 Apr 09 ; 53(15) 2442 | DOI : 10.1021/bi401606f

  • P. Narayan
  • et al

Direct Observations of Amyloid β Self-Assembly in Live Cells Provide Insights into Differences in the Kinetics of Aβ (1–40) and Aβ (1–42) Aggregation.

Chem Biol . 2014 Jun 19 ; 21(6) 732 | DOI : 10.1016/j.chembiol.2014.03.014

  • EK. Esbjörner