Peptides

Beta-Amyloid (1-40), TAMRA-labeled - 0.1 mg

224.00
Check your price
  • Cat.Number : AS-60488-01
  • Availability :
    In stock

Select specification

Quantity

This is a fluorescent (TAMRA)-labeled ß-Amyloid peptide, Abs/Em=544/572 nm. Beta-Amyloid (1-40) together with beta-Amyloid (1-42) are two major C-terminal variants of the beta-Amyloid protein. These beta-Amyloid peptides undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.

544/572

Specifications

Chemistry
Sequence one letter code
  • TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 1802087-81-5
Molecular Formula
  • C219H315N55O62S
Molecular Mass/ Weight
  • 4742,3
Properties
Absorbance (nm)
  • 544
Emission (nm)
  • 572
Modification
Conjugation type
  • Fluorescent dyes
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C Protected from light
Activity
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube AggreSure Beta-Amyloid (1-40), human - 0.25 mg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
263.00 Excl. Tax
Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
285.00 Excl. Tax

Citations

Transmission electron microscopy characterization of fluorescently labelled amyloid β 1-40 and α-synuclein aggregates

BMC Biotechnol . 2011 Dec 19 ; 11 125 | DOI : 10.1186/1472-6750-11-125

  • VL. Anderson
  • WW. Webb

Spreading of amyloid-β peptides via neuritic cell-to-cell transfer is dependent on insufficient cellular clearance.

Neurobiol Disease . 2014 Jan 09 ; 65 82 | DOI : 10.1016/j.nbd.2013.12.019.

  • J. Domert
  • et al