Peptides

Beta-Amyloid (1-42), Scrambled, 5-FAM labeled - 0.1 mg

240.00
Check your price
  • Cat.Number : AS-60892
  • Availability :
    In stock

Select specification

Quantity

Aß (1-42), a major component of amyloid plaques, accumulates in neurons of Alzheimer’s disease brains. Biochemical analysis of the amyloid peptides isolated from Alzheimer’s disease brain indicates that Aß (1-42) is the principal species associated with senile plaque amyloids, while Aß (1-40) is more abundant in cerebrovascular amyloid deposit. This beta-amyloid (1-42) peptide is FAM-labeled (Abs/Em=494/521 nm).

Specifications

Chemistry
Sequence one letter code
  • 5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Sequence three letter code
  • 5-FAM-Ala-Ile-Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe-Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-Asp-Leu-Gly-Ser-His-Asn-Val-Ala-OH
Molecular Formula
  • C224H321N55O66S1
Molecular Mass/ Weight
  • 4872.7
Properties
Absorbance (nm)
  • 494
Emission (nm)
  • 521
Modification
Conjugation type
  • Fluorescent dyes
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C Protected from light
Activity
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
285.00 Excl. Tax
Image of a kit SensoLyte 520 Neprilysin Activity Assay Kit Fluorimetric

SensoLyte® 520 Neprilysin Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72223
509.00 Excl. Tax
Image of a kit SensoLyte Thioflavin T Beta-Amyloid (1-42) Aggregation Kit

SensoLyte® Thioflavin T ß-Amyloid (1-42) Aggregation Kit - 1 kit

Cat.Number : AS-72214
509.00 Excl. Tax

Citations

Aβ induces cell death by direct interaction with its cognate extracellular domain on APP (APP 597–624).

FASEB Journal. . 2006 Apr 24 ; 20(8) 1254 | DOI : https://doi.org/10.1096/fj.05-5032fje

  • GM. Shaked
  • et al