Peptides

Beta-Amyloid (11-42) - 1 mg

288,00
Check your price
  • Cat.Number : AS-63317-
  • Availability :
    In stock

Select specification

Quantity

This is amino acids 11 to 42 fragment of beta-amyloid. This peptide was detected in Alzheimer disease brains within several principal beta-amyloid variants.

Specifications

Chemistry
Sequence one letter code
  • EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence three letter code
  • H-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
CAS registry number
  • 157802-70-5
Molecular Formula
  • C152H244N40O42S
Molecular Mass/ Weight
  • 3335.9
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
271,00