Peptides

Beta-Amyloid (11-42), HiLyte™ Fluor 488-labeled - 0.1 mg

172,00
Check your price
  • Cat.Number : AS-63327
  • Availability :
    In stock

Select specification

Quantity

This is amino acids 11 to 42 fragment of β-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this β-amyloid peptide within the insoluble amyloid pools. HiLyte™ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).

Specifications

Chemistry
Sequence one letter code
  • HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence three letter code
  • Hilyte™ Fluor 488-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Molecular Mass/ Weight
  • 3692.5
Properties
Absorbance (nm)
  • 503
Emission (nm)
  • 528
Modification
Conjugation type
  • Fluorescent dyes
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
271,00