Peptides

Beta-Amyloid (3-40) - 0.1 mg

93.00
Check your price
  • Cat.Number : AS-61029
  • Availability :
    In stock

Select specification

Quantity

This peptide is beta-amyloid (1-40) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-40). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-40) and Aß (11- 40) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.

Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.

Specifications

Chemistry
Sequence one letter code
  • EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • H-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 157884-70-3
Molecular Formula
  • C187H285N51O54S
Molecular Mass/ Weight
  • 4144
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube AggreSure Beta-Amyloid (1-40), human - 0.25 mg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
263.00 Excl. Tax
Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
285.00 Excl. Tax