Peptides

Beta-Amyloid (5-42)

136,00
Check your price
  • Cat.Number : AS-60087-01
  • Availability :
    In stock

Size

Quantity

A variety of truncated and modified Aβ peptides have been described (for example, 1-28, 1-29, 1-45, 2-46, 3-44, 3-47, 2-42, 4-42, 5-42, 6-42, 7-45, 8-42)

Specifications

Chemistry
Sequence one letter code
  • RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence three letter code
  • H-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Molecular Formula
  • C182H285N51O52S
Molecular Mass/ Weight
  • 4051.9
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
271,00

Citations

N-truncation and pyroglutaminylation enhances the opsonizing capacity of Aβ-peptides and facilitates phagocytosis by macrophages and microglia.

Brain Behav Immun . 2014 May 27 ; 41 116 | DOI : 10.1016/j.bbi.2014.05.003.

  • M. Condic
  • et al