Peptides

Beta-Amyloid Peptide (1-40), mouse, rat

269.00
Check your price
  • Cat.Number : AS-25380-
  • Availability :
    In stock

Select specification

Size

Quantity

This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.

Specifications

Chemistry
Sequence one letter code
  • DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 144409-98-3
Molecular Formula
  • C190H291N51O57S
Molecular Mass/ Weight
  • 4234.1
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • mouse, rat
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube AggreSure Beta-Amyloid (1-40), human - 0.25 mg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
263.00 Excl. Tax
Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
285.00 Excl. Tax

Citations

β-amyloid peptide-induced apoptosis regulated by a novel protein containing a G protein activation module

J Biol Chem. . 2001 Feb 20 ; 276(22) 18748 | DOI : 10.1074/jbc.M011161200

  • EM. Kajkowski
  • et al