Labeling & detection

Our portfolio includes fluorescent and non-fluorescent dyes, derivatives of streptavidin and biotin, etc.

    301 - 320 of 328

    HCV Protease FRET Substrate (RET S1)

    • Ac-DE-D(Edans)-EE-Abu-ψ-[COO]-AS-K(Dabcyl)-NH2
    • Cat.Number : AS-22991

    S6 Kinase Substrate (229-239)

    • AKRRRLSSLRA
    • Cat.Number : AS-27191

    MMP Colorimetric Substrate - 1 mg

    • Ac-PLG-SCH[CH2CH(CH3)2]-CO-LG-OC2H5
    • Cat.Number : AS-27096

    390 MMP FRET Substrate 1 - 1 mg

    • Mca-PLGL-Dap(Dnp)-AR-NH2
    • Cat.Number : AS-27076

    Streptavidin

    • Cat.Number : AS-60659

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01
      301 - 320 of 328