Peptides

Calcitonin, human

137.00
Check your price
  • Cat.Number : AS-20673
  • Availability :
    In stock

Select specification

Size

Quantity

Human calcitonin reduces blood calcium, opposing the effects of parathyroid hormone (PTH). It stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease.

Specifications

Chemistry
Sequence one letter code
  • CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
Sequence three letter code
  • H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge: 1-7)
CAS registry number
  • 21215-62-3
Molecular Formula
  • C151H226N40O45S3
Molecular Mass/ Weight
  • 3418.1
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of (Gla17,21,24)-Osteocalcin (1-49) peptide

[Gla17,21,24]-Osteocalcin (1-49)

Cat.Number : AS-22829
127.00 Excl. Tax
Tube of Parathyroid Hormone (1-34) peptide

Parathyroid Hormone (1-34), human - 1 mg

Cat.Number : AS-20708
171.00 Excl. Tax
Image of a kit SensoLyte 520 Calpain Activity Assay Kit Fluorimetric

SensoLyte® 520 Calpain Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72149
509.00 Excl. Tax