Peptides

Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) - 1 mg

447,00
Check your price
  • Cat.Number : AS-62565
  • Availability :
    In stock

Quantity

This chimeric peptide is a fragment derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding, this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice, RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood–brain barrier.

Specifications

Chemistry
Sequence one letter code
  • YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Sequence three letter code
  • H-Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH
CAS registry number
  • 1678417-57-6
Molecular Formula
  • C201H334N82O55S2
Molecular Mass/ Weight
  • 4843.5
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • Rabies virus

You may also be interested in the following product(s)

Tube of (Arg)9 peptide

(Arg)9 - 1 mg

Cat.Number : AS-61204
56,00
Tube of FITC-LC-Antennapedia Peptide

FITC-LC-Antennapedia Peptide

Cat.Number : AS-24175
149,00
Tube of TAT (47-57) peptide, TAMRA-labeled

TAT (47-57), TAMRA-labeled - 1 mg

Cat.Number : AS-61211
213,00