Peptides

Chlorotoxin (Cltx) - 0.1 mg

106,00
Check your price
  • Cat.Number : AS-60770
  • Availability :
    In stock

Quantity

A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.

Specifications

Chemistry
Sequence one letter code
  • MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
Sequence three letter code
  • H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
CAS registry number
  • 163515-35-3
Molecular Formula
  • C158H249N53O47S11
Molecular Mass/ Weight
  • 3996
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • Scorpion

You may also be interested in the following product(s)

Tube of Caloxin 2A1 peptide

Caloxin 2A1 - 1 mg

Cat.Number : AS-62604
102,00
Tube of Iberiotoxin (IbTX) peptide

Iberiotoxin (IbTX) - 0.1 mg

Cat.Number : AS-60763
147,00
Tube of omega-Conotoxin GVIA peptide,

ω-Conotoxin GVIA

Cat.Number : AS-22926
223,00

Citations

Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation.

Nanotechnololgy . 2010 May 17 ; 21(23) 235104 | DOI : 10.1088/0957-4484/21/23/235104

  • J. Wan
  • et al

Specific targeting of gliomas with multifunctional superparamagnetic iron oxide nanoparticle optical and magnetic resonance imaging contrast agents

Acta Pharmacol Sin . 2007 Dec 01 ; 28(12) 2019 | DOI : https://doi.org/10.1111/j.1745-7254.2007.00661.x

  • X. Meng
  • et al