Peptides

[Cys26]-beta-Amyloid (1-42)

233,00
Check your price
  • Cat.Number : AS-63672-05
  • Availability :
    In stock

Select specification

Size

Quantity

Subsitution of Ser 26 with Cys in Aβ1-42 allows the generation of the covalently linked Aβ42 homodimer. Dimerization can be reverted by adding a reducing agent. This Cys-containing mutant can be used as a model for aggregation studies.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Cys-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Molecular Formula
  • C203H311N55O59S2
Molecular Mass/ Weight
  • 4530.5
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
271,00