Peptides

Exendin (5-39) - 1 mg

240.00
Check your price
  • Cat.Number : AS-63898
  • Availability :
    In stock

Quantity

This truncated Exendin-4 peptide, Exendin (5-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (5-39) antagonizes GLP-1–stimulated insulin release after food intake.

Specifications

Chemistry
Sequence one letter code
  • TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence three letter code
  • H-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Molecular Formula
  • C169H262N44O54S
Molecular Mass/ Weight
  • 3806.5
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • Gila
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of GIP peptide, rat

GIP, rat

Cat.Number : AS-65568-05
198.00 Excl. Tax
Image of a kit SensoLyte 520 IDE Activity Assay Kit Fluorimetric

SensoLyte® 520 IDE Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72231
509.00 Excl. Tax