Peptides

Exendin (9-39)

230.00
Check your price
  • Cat.Number : AS-24467
  • Availability :
    In stock

Size

Quantity

This truncated Exendin-4 peptide, Exendin (9-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (9-39) antagonizes GLP-1–stimulated insulin release after food intake. It is a competitive inhibitor of Exendin-3 and Exendin-4.

Specifications

Chemistry
Sequence one letter code
  • DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence three letter code
  • H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
CAS registry number
  • 133514-43-9
Molecular Formula
  • C149H234N40O47S
Molecular Mass/ Weight
  • 3370
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • Gila
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of GIP peptide, rat

GIP, rat

Cat.Number : AS-65568-05
198.00 Excl. Tax
Image of a kit SensoLyte 520 IDE Activity Assay Kit Fluorimetric

SensoLyte® 520 IDE Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72231
509.00 Excl. Tax

Citations

Colesevelam suppresses hepatic glycogenolysis by TGR5-mediated induction of GLP-1 action in DIO mice.

Am J Physiol Gastrointest Liver Physiol . 2012 Dec 20 ; 304(4) G371 | DOI : 10.​1152/​ajpgi.​00400.​2012.

  • MJ. Potthoff
  • et al