Peptides

Gastrin Releasing Peptide, human

114.00
Check your price
  • Cat.Number : AS-24213
  • Availability :
    In stock

Size

Quantity

Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, stimulates the release of Gastrin, and shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells.

Specifications

Chemistry
Sequence one letter code
  • VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Sequence three letter code
  • H-Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
CAS registry number
  • 93755-85-2
Molecular Formula
  • C130H204N38O31S2
Molecular Mass/ Weight
  • 2859.6
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Leptin (93-105) peptide, human

Leptin (93-105), human - 1 mg

Cat.Number : AS-62853
83.00 Excl. Tax
Tube of Secretin peptide, rat

Secretin, rat - 1 mg

Cat.Number : AS-60677
219.00 Excl. Tax
Image of a kit SensoLyte 520 Enterokinase Assay Kit Fluorimetric

SensoLyte® 520 Enterokinase Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72209
509.00 Excl. Tax