Peptides

[Gln22]-beta-Amyloid (1-40), Dutch Mutation - 0.5 mg

176,00
Check your price
  • Cat.Number : AS-61261
  • Availability :
    In stock

Select specification

Quantity

Several mutations within the β-amyloid precursor gene cause early onset familial Alzheimer's disease, and were shown to promote Aβ aggregation. In the dutch mutant, Glu 22 is replaced with Gln, leading to rapid formation of neuroteoxic aggregates with higher proteolysis resistance.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 144410-00-4
Molecular Formula
  • C194H296N54O57S
Molecular Mass/ Weight
  • 4329.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube AggreSure Beta-Amyloid (1-40), human - 0.25 mg

AggreSure ß-Amyloid (1-40), human - 0.25 mg

Cat.Number : AS-72215
250,00
Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
271,00

Citations

Vascular cell lines expressing SSAO/VAP‐1: a new experimental tool to study its involvement in vascular diseases.

Biol Cell . 2011 Nov 01 ; 103(11) 543 | DOI : 10.1042/BC20110049

  • M. Sole
  • M. Unzeta