Peptides

[Gln22]-beta-Amyloid (1-42), Dutch mutation - 0.5 mg

269.00
Check your price
  • Cat.Number : AS-62142
  • Availability :
    In stock

Select specification

Quantity

This peptide is a naturally occurring mutant form of the wild type (WT) beta-Amyloid 1 to 42 peptide. The E22Q "Dutch" mutant, also known as HCHWA-D, is caused by a point mutation in the beta-Amyloid encoding gene, with Glu replaced by Gln at position 22. Dutch E22Q mutation in beta-Amyloid causes familial cerebrovascular amyloidosis with abundant diffused amyloid plaque deposits. E22Q mutant and WT peptides are both stable in "collapsed coil" conformations. The E22Q fibrils are more toxic for vascular cells than the WT fibrils.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Molecular Formula
  • C203H312N56O59S1
Molecular Mass/ Weight
  • 4513.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
285.00 Excl. Tax
Image of a kit SensoLyte 520 Neprilysin Activity Assay Kit Fluorimetric

SensoLyte® 520 Neprilysin Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72223
509.00 Excl. Tax
Image of a kit SensoLyte Thioflavin T Beta-Amyloid (1-42) Aggregation Kit

SensoLyte® Thioflavin T ß-Amyloid (1-42) Aggregation Kit - 1 kit

Cat.Number : AS-72214
509.00 Excl. Tax