Peptides

Growth Hormone Releasing Factor, GRF (1-29), amide, human

71,00
Check your price
  • Cat.Number : AS-22874
  • Availability :
    In stock

Size

Quantity

This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.

Specifications

Chemistry
Sequence one letter code
  • YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Sequence three letter code
  • H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
CAS registry number
  • 86168-78-7
Molecular Formula
  • C149H246N44O42S
Molecular Mass/ Weight
  • 3357.9
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

Tube of (Arg8)-Vasopressin (AVP) peptide

[Arg8]-Vasopressin (AVP) Peptide

Cat.Number : AS-24289
30,00
Tube of ACTH (1-39) peptide, human

ACTH (1-39), human

Cat.Number : AS-20611
198,00
Tube of Oxytocin peptide

Oxytocin Peptide

Cat.Number : AS-24275
66,00