Peptides

HA Tag 3X - 1 mg

329,00
Check your price
  • Cat.Number : AS-63764
  • Availability :
    In stock

Quantity

This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.

Specifications

Chemistry
Sequence one letter code
  • MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
Sequence three letter code
  • H-Met-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Lys-Leu-Glu-OH
Molecular Formula
  • C205H272N38O67S1
Molecular Mass/ Weight
  • 4372.9
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of DYKDDDDK peptide

DYKDDDDK tag, Flag tag - 5 mg

Cat.Number : AS-60738
184,00
Tube of HA Tag Peptide

HA Tag

Cat.Number : AS-21156
46,00
Tube of His Tag Peptide

His Tag Peptide

Cat.Number : AS-24420
89,00