Peptides

Histone H3 (1-50)-GGK(Biotin) - 0.25 mg

535,00
Check your price
  • Cat.Number : AS-65366-025
  • Availability :
    In production

Quantity

This peptide is histone H3 (1-50) biotinylated through a C-terminal GGK linker. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.

Specifications

Chemistry
Sequence one letter code
  • ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE-GGK(Biotin)
Sequence three letter code
  • H-Ala-Arg-Thr-Lys-Gln-Thr-Ala-Arg-Lys-Ser-Thr-Gly-Gly-Lys-Ala-Pro-Arg-Lys-Gln-Leu-Ala-Thr-Lys-Ala-Ala-Arg-Lys-Ser-Ala-Pro-Ala-Thr-Gly-Gly-Val-Lys-Lys-Pro-His-Arg-Tyr-Arg-Pro-Gly-Thr-Val-Ala-Leu-Arg-Glu-Gly-Gly-Lys(Biotin)-OH
Molecular Mass/ Weight
  • 5809.8
Modification
Conjugation type
  • Biotins
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

Tube of Histone H4 (1-21) K5/8/12/16Ac-Biot peptide

[Lys(Ac)5/8/12/16]-Histone H4 (1-21)-GGK(Biotin) - 1 mg

Cat.Number : AS-64989-1
355,00
Tube of Histone H3 (1-21) peptide, GGK(Biot)-NH2

Histone H3 (1-21)-GGK(Biotin)-NH2 - 1 mg

Cat.Number : AS-61702
212,00
Tube of Histone H3 (21-44)-GK(Biot) peptide

Histone H3 (21-44)-GK(Biotin)

Cat.Number : AS-64440-025
106,00