Peptides

[Met(O)35]-beta-Amyloid (1-42) - 0.5 mg

296.00
Check your price
  • Cat.Number : AS-62478
  • Availability :
    In stock

Select specification

Quantity

Beta-amyloid 1-42, the major protein component of brain senile plaques in Alzheimer's disease, is known to be directly responsible for the production of free radicals toxic to brain tissue. The redox state of Met-35 seems to play a role in peptide's neurotoxic actions by altering the cell deatch pathway mediated by Bax / Blc2. In this peptide, Met35 is in the sulfoxide form.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met(O)-Val-Gly-Gly-Val-Val-Ile-Ala-OH
CAS registry number
  • 1802086-68-5
Molecular Formula
  • C203H311N55O61S
Molecular Mass/ Weight
  • 4530.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Beta-Amyloid (1-42) peptide

Beta-Amyloid (1-42)

Cat.Number : AS-20276
285.00 Excl. Tax
Image of a kit SensoLyte 520 Neprilysin Activity Assay Kit Fluorimetric

SensoLyte® 520 Neprilysin Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72223
509.00 Excl. Tax
Image of a kit SensoLyte Thioflavin T Beta-Amyloid (1-42) Aggregation Kit

SensoLyte® Thioflavin T ß-Amyloid (1-42) Aggregation Kit - 1 kit

Cat.Number : AS-72214
509.00 Excl. Tax