Peptides

OVA (241-270) - 1 mg

213.00
Check your price
  • Cat.Number : AS-64525
  • Availability :
    In stock

Quantity

This peptide is OVA peptide residues 241 to 270. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).

Specifications

Chemistry
Sequence one letter code
  • SMLVLLPDEVSGLEQLESIINFEKLTEWTS
Sequence three letter code
  • H-Ser-Met-Leu-Val-Leu-Leu-Pro-Asp-Glu-Val-Ser-Gly-Leu-Glu-Gln-Leu-Glu-Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu-Thr-Glu-Trp-Thr-Ser-OH
Molecular Formula
  • C154H246N34O51S1
Molecular Mass/ Weight
  • 3421.9
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • chicken
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of OVA (257-264) peptide

OVA (257-264) Peptide Fragment

Cat.Number : AS-60193-1
50.00 Excl. Tax
Tube of OVA (323-339) peptide, TAMRA labeled

OVA (323-339), TAMRA labeled - 1 mg

Cat.Number : AS-64232
279.00 Excl. Tax
Tube of OVA (329-337) peptide

OVA (329-337) - 1 mg

Cat.Number : AS-64777
78.00 Excl. Tax