Peptides

PACAP (6-38), amide, human, ovine, rat

171.00
Check your price
  • Cat.Number : AS-22516
  • Availability :
    In stock

Select specification

Size

Quantity

This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.

Specifications

Chemistry
Sequence one letter code
  • FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Sequence three letter code
  • H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
CAS registry number
  • 143748-18-9
Molecular Formula
  • C182H300N56O45S
Molecular Mass/ Weight
  • 4025
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human, ovine, rat
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of (Arg8)-Vasopressin (AVP) peptide

[Arg8]-Vasopressin (AVP) Peptide

Cat.Number : AS-24289
33.00 Excl. Tax
Tube of ACTH (1-39) peptide, human

ACTH (1-39), human

Cat.Number : AS-20611
214.00 Excl. Tax
Tube of Oxytocin peptide

Oxytocin Peptide

Cat.Number : AS-24275
71.00 Excl. Tax