Peptides

Peptide YY (3-36), human

132,00
Check your price
  • Cat.Number : AS-24405
  • Availability :
    In production

Select specification

Size

Quantity

This peptide, a PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake.

Specifications

Chemistry
Sequence one letter code
  • IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Sequence three letter code
  • H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
CAS registry number
  • 123583-37-9
Molecular Formula
  • C180H279N53O54
Molecular Mass/ Weight
  • 4049.5
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

Tube of Caerulein peptide

Caerulein, Ceruletide - 1 mg

Cat.Number : AS-24252
183,00
Tube of Secretin peptide, rat

Secretin, rat - 1 mg

Cat.Number : AS-60677
203,00