Peptides

SARS-CoV-2 Spike receptor binding domain, RBD (395-430) - 0.5 mg

376.00
Check your price
  • Cat.Number : AS-65613
  • Availability :
    In stock

Select specification

Quantity

This peptide sequence represents residues 395-430 of the RBD (receptor binding domain) identified from the RefSeq (YP_009724390.1) from the spike protein of SARS-CoV-2.

Specifications

Chemistry
Sequence one letter code
  • VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT
Sequence three letter code
  • H-Val-Tyr-Ala-Asp-Ser-Phe-Val-Ile-Arg-Gly-Asp-Glu-Val-Arg-Gln-Ile-Ala-Pro-Gly-Gln-Thr-Gly-Lys-Ile-Ala-Asp-Tyr-Asn-Tyr-Lys-Leu-Pro-Asp-Asp-Phe-Thr-OH
Molecular Mass/ Weight
  • 4063.8
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • 95,00%
Storage & stability
Storage Conditions
  • - 20 °C
Activity
Application
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • SARS-CoV-2
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)