Peptides

TAT-HA2 Fusion Peptide - 1 mg

214.00
Check your price
  • Cat.Number : AS-64876
  • Availability :
    In stock

Quantity

This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.

Specifications

Chemistry
Sequence one letter code
  • RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
Sequence three letter code
  • H-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly-OH
Molecular Formula
  • C149H243N53O39S1
Molecular Mass/ Weight
  • 3433.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • HIV, Influenza
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of (Arg)9 peptide

(Arg)9 - 1 mg

Cat.Number : AS-61204
61.00 Excl. Tax
Tube of Mastoparan peptide

Cell Permeable-Mastoparan Peptide

Cat.Number : AS-24270
48.00 Excl. Tax
Tube of FITC-LC-Antennapedia Peptide

FITC-LC-Antennapedia Peptide

Cat.Number : AS-24175
162.00 Excl. Tax