Peptides

TAT-NSF700scr - 1 mg

307.00
Check your price
  • Cat.Number : AS-62209
  • Availability :
    In stock

Quantity

This scrambled human immunodeficiency virus (HIV) transactivator of transcription (TAT) N-ethylmaleimide-sensitive factor (NSF) 700scr peptide is used as a control peptide to TAT-NSF700 peptide. It does not inhibit the disassembly activity of NSF in contrast to the TAT-NSF700 which plays a critical role in regulating exocytosis.

Specifications

Chemistry
Sequence one letter code
  • YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
Sequence three letter code
  • H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Ile-Pro-Pro-Val-Tyr-Phe-Ser-Arg-Leu-Asp-Leu-Asn-Leu-Val-Val-Leu-Leu-Leu-Ala-Gln-Leu-OH
Molecular Formula
  • C186H315N61O44
Molecular Mass/ Weight
  • 4110.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • HIV
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of (Arg)9 peptide

(Arg)9 - 1 mg

Cat.Number : AS-61204
61.00 Excl. Tax
Tube of Mastoparan peptide

Cell Permeable-Mastoparan Peptide

Cat.Number : AS-24270
48.00 Excl. Tax
Tube of FITC-LC-Antennapedia Peptide

FITC-LC-Antennapedia Peptide

Cat.Number : AS-24175
162.00 Excl. Tax

Citations

P2X4-Receptor-Mediated Synthesis and Release of Brain-Derived Neurotrophic Factor in Microglia Is Dependent on Calcium and p38-Mitogen-Activated Protein Kinase Activation

J Neurosci. . 2009 Mar 18 ; 29(11) 3518 | DOI : 10.1523/JNEUROSCI.5714-08.2009

  • T. Trang

A Novel Inhibitor of N-Ethylmaleimide-Sensitive Factor Decreases Leukocyte Trafficking and Peritonitis

J Pharmacol Exp Ther . 2005 Mar 18 ; 314(1) 155 | DOI : 10.1124/jpet.104.082529

  • CN. Morrell
  • et al