Peptides

Tau peptide (337-368) (Repeat4 domain) - 1 mg

78.00
Check your price
  • Cat.Number : AS-65436-1
  • Availability :
    In stock

Quantity

TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.

Specifications

Chemistry
Sequence one letter code
  • VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
Sequence three letter code
  • Val-Glu-Val-Lys-Ser-Glu-Lys-Leu-Asp-Phe-Lys-Asp-Arg-Val-Gln-Ser-Lys-Ile-Gly-Ser-Leu-Asp-Asn-Ile-Thr-His-Val-Pro-Gly-Gly-Gly-Asn-OH
Molecular Formula
  • C150H248N44O50
Molecular Mass/ Weight
  • 3467.86
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of KKW-Tau S400(OGlcNAc)-K(Biot)-NH2 peptide

Ser(OGlcNAc)]400-KWK-Tau (388-411)-KK(Biotin)-NH2 - 1 mg

Cat.Number : AS-65409-1
384.00 Excl. Tax
Tube of Tau peptide (244-274) (Repeat1)

Tau peptide (244-274) (Repeat1 domain) - 1 mg

Cat.Number : AS-65433-1
71.00 Excl. Tax
Tube of Tau peptide (45-73) (Exon2/Insert1)

Tau peptide (45-73) (Exon2/Insert1 domain) - 1 mg

Cat.Number : AS-65431-1
59.00 Excl. Tax