Peptides

ACTH (7-38), human - 1 mg

122.00
Check your price
  • Cat.Number : AS-20618
  • Availability :
    In stock

Select specification

Quantity

Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.

Specifications

Chemistry
Sequence one letter code
  • FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Sequence three letter code
  • H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
CAS registry number
  • 68563-24-6
Molecular Formula
  • C167H257N47O46
Molecular Mass/ Weight
  • 3659.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Kisspeptin-10 (112-121) human peptide

Kisspeptin-10 (Kp-10) (112-121), Metastin (45-54), human - 1 mg

Cat.Number : AS-64240
61.00 Excl. Tax
Vial of LH-RH peptide, human

Luteinizing Hormone-Releasing Hormone (LH-RH), human - 25 mg

Cat.Number : AS-20782
165.00 Excl. Tax
Tube of PACAP(1-38) peptide

PACAP (1-38), amide, human, ovine, rat

Cat.Number : AS-22519
181.00 Excl. Tax