Peptides

    1 - 20 of 24

    Bovine ß-Casein, monophosphopeptide - 1 mg

    • FQ-pS-EEQQQTEDELQDK
    • Cat.Number : AS-61146

    ClearPoint™ BSA (347-359), Isotopic labeled, Mass Spec Standard - 0.1 mg

    • DAF-L*-GSF-L*-YEYSR [L* = L(U13C6, 15N)]
    • Cat.Number : AS-61220

    HA 12CA5 Epitope Tag - 1 mg

    • CYPYDVPDYA
    • Cat.Number : AS-62229

    HA Tag

    • YPYDVPDYA
    • Cat.Number : AS-21156

    HA Tag 3X - 1 mg

    • MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
    • Cat.Number : AS-63764

    His Tag Peptide

    • HHHHHH
    • Cat.Number : AS-24420

    MAPS, Core, 8-Branch - 10 mg

    • (K)4-(K)2-K-A
    • Cat.Number : AS-21006
      1 - 20 of 24