Catalog

    1 - 2 of 2

    Peptide YY (3-36), human

    IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

    Peptide YY, human

    YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
      1 - 2 of 2