Peptides

C34, gp41 HIV Fragment - 1 mg

296.00
Check your price
  • Cat.Number : AS-62101
  • Availability :
    In stock

Quantity

This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.

Specifications

Chemistry
Sequence one letter code
  • WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
Sequence three letter code
  • H-Trp-Met-Glu-Trp-Asp-Arg-Glu-Ile-Asn-Asn-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-OH
Molecular Formula
  • C184H280N50O64S1
Molecular Mass/ Weight
  • 4248.8
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • HIV
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

IMG-EN-AS-61017-10-01.JPG

HCV NS3/4A protease genotype 1b, recombinant

Cat.Number : AS-61017-5
246.00 Excl. Tax
Image of a kit SensoLyte 520 HIV Protease Assay Kit Fluorimetric

SensoLyte® 520 HIV Protease Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-71147
465.00 Excl. Tax