Peptides

Cecropin A Peptide

175.00
Check your price
  • Cat.Number : AS-24009
  • Availability :
    In stock

Select specification

Size

Quantity

Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients.

Specifications

Chemistry
Sequence one letter code
  • KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
Sequence three letter code
  • H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
CAS registry number
  • 80451-04-3
Molecular Formula
  • C184H313N53O46
Molecular Mass/ Weight
  • 4004.1
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • moth
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of flg22 peptide, Flagellin Fragment

flg22, Flagellin Fragment - 1 mg

Cat.Number : AS-62633
181.00 Excl. Tax
Tube of hBD-1 peptide, ?-Defensin-1 peptide, human

hBD-1, b-Defensin-1, human - 0.1 mg

Cat.Number : AS-60740
309.00 Excl. Tax
Tube of LL-37 peptide, human

LL-37, Antimicrobial Peptide, human - 1 mg

Cat.Number : AS-61302
182.00 Excl. Tax

Citations

Combination effects of antimicrobial peptides

Antimicrob Agents Chemother . 2016 Jan 04 ; 60(3) 1717 | DOI : 10.1128/AAC02434-15.

  • G. Yu
  • et al

Mechanism of action and initial evaluation of a membrane active all-D-enantiomer antimicrobial peptidomimetic.

PNAS . 2013 Jan 23 ; 110(9) 3477 | DOI : 10.1073/pnas.1221924110.

  • D. McGrath
  • et al

Antimicrobial peptides as new recognition molecules for screening challenging species.

Sens Actuators B Chem. . 2007 Jan 30 ; 121(1) 150 | DOI : 10.1016/j.snb.2006.09.044.

  • NV. Kulagina
  • et al