Peptides

Elafin - 0.1 mg

236.00
Check your price
  • Cat.Number : AS-61641
  • Availability :
    In stock

Quantity

This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.

Specifications

Chemistry
Sequence one letter code
  • AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
Sequence three letter code
  • H-Ala-Gln-Glu-Pro-Val-Lys-Gly-Pro-Val-Ser-Thr-Lys-Pro-Gly-Ser-Cys-Pro-Ile-Ile-Leu-Ile-Arg-Cys-Ala-Met-Leu-Asn-Pro-Pro-Asn-Arg-Cys-Leu-Lys-Asp-Thr-Asp-Cys-Pro-Gly-Ile-Lys-Lys-Cys-Cys-Glu-Gly-Ser-Cys-Gly-Met-Ala-Cys-Phe-Val-Pro-Gln-OH (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
Molecular Mass/ Weight
  • 5999.5
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human, chimpanzee
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of flg22 peptide, Flagellin Fragment

flg22, Flagellin Fragment - 1 mg

Cat.Number : AS-62633
181.00 Excl. Tax
Tube of hBD-1 peptide, ?-Defensin-1 peptide, human

hBD-1, b-Defensin-1, human - 0.1 mg

Cat.Number : AS-60740
309.00 Excl. Tax
Tube of LL-37 peptide, human

LL-37, Antimicrobial Peptide, human - 1 mg

Cat.Number : AS-61302
182.00 Excl. Tax

Citations

Neutrophil proteinase 3 acts on protease-activated receptor-2 to enhance vascular endothelial cell barrier function.

Arterioscler Thromb Vasc Biol . 2012 Nov 29 ; 33(2) 275 | DOI : 10.1161/​ATVBAHA.112.300474

  • CJ. Kuckleburg
  • PJ. Newman