Peptides

Glucagon (1-29), bovine, human, rat, porcine, FAM-labeled - 1 mg

253.00
Check your price
  • Cat.Number : AS-60273-1
  • Availability :
    In stock

Select specification

Quantity

This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.

Specifications

Chemistry
Sequence one letter code
  • FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Sequence three letter code
  • FAM-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH
Molecular Formula
  • C174H235N43O55S
Molecular Mass/ Weight
  • 3841.3
Properties
Absorbance (nm)
  • 494
Emission (nm)
  • 521
Modification
Conjugation type
  • Fluorescent dyes
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C Protected from light
Activity
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • bovine, human, rat, porcine
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of GIP peptide, rat

GIP, rat

Cat.Number : AS-65568-05
198.00 Excl. Tax