Peptides

Glucagon-Like Peptide 1, GLP-1 (1-36) amide, human, mouse, rat, bovine, guinea pig, FAM-labeled

306.00
Check your price
  • Cat.Number : AS-23606
  • Availability :
    In stock

Select specification

Size

Quantity

This is fluorescent GLP-1 labeled at the peptide N-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.

Specifications

Chemistry
Sequence one letter code
  • FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence three letter code
  • FAM-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Molecular Formula
  • C205H283N51O63
Molecular Mass/ Weight
  • 4470
Properties
Absorbance (nm)
  • 494
Emission (nm)
  • 521
Modification
Conjugation type
  • Fluorescent dyes
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C Protected from light
Activity
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Exendin-4 peptide

Exendin 4

Cat.Number : AS-24463
182.00 Excl. Tax
Tube of GIP peptide, rat

GIP, rat

Cat.Number : AS-65568-05
198.00 Excl. Tax
Image of a kit SensoLyte 520 IDE Activity Assay Kit Fluorimetric

SensoLyte® 520 IDE Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72231
509.00 Excl. Tax