Peptides

Glucagon-Like Peptide 1, GLP-1 (7-37) human, mouse, rat, bovine, guinea pig

154.00
Check your price
  • Cat.Number : AS-20761
  • Availability :
    In stock

Size

Quantity

GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated.

Specifications

Chemistry
Sequence one letter code
  • HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Sequence three letter code
  • H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
CAS registry number
  • 106612-94-6
Molecular Formula
  • C151H228N40O47
Molecular Mass/ Weight
  • 3355.9
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human, sheep, rat, mouse, hamster, bovine
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Exendin-4 peptide

Exendin 4

Cat.Number : AS-24463
182.00 Excl. Tax
Tube of GIP peptide, rat

GIP, rat

Cat.Number : AS-65568-05
198.00 Excl. Tax
Image of a kit SensoLyte 520 IDE Activity Assay Kit Fluorimetric

SensoLyte® 520 IDE Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72231
509.00 Excl. Tax