Peptides

Glucagon-Like Peptide 1, GLP-1 (9-36), amide, human, mouse, rat, bovine, guinea pig - 1 mg

320.00
Check your price
  • Cat.Number : AS-65070
  • Availability :
    In stock

Quantity

GLP-1 (9-36) is the result of the rapid degradation of GLP-1 (7-36) amide, by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. GLP-1 (9-36) accounts for the majority of GLP-1 that reaches the system circulation. Whereas GLP-1 (7-36) amide stimulates glucose-dependent insulin secretion and inhibits glucagon secretion, GLP-1(9-36) amide administration had no effect on glucose clearance or insulin secretion in humans. GLP-1(9-36) amide however was shown to exert cardioprotective actions in rodent hearts.

Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.

Specifications

Chemistry
Sequence one letter code
  • EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence three letter code
  • H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
CAS registry number
  • 161748-29-4
Molecular Formula
  • C140H214N36O43
Molecular Mass/ Weight
  • 3089.6
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Exendin-4 peptide

Exendin 4

Cat.Number : AS-24463
320.00 Excl. Tax
Tube of GIP peptide, rat

GIP, rat

Cat.Number : AS-65568-05
254.00 Excl. Tax
Image of a kit SensoLyte 520 IDE Activity Assay Kit Fluorimetric

SensoLyte® 520 IDE Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72231
662.00 Excl. Tax